30-MINUTE MEALS! Get the email series now
magic meal ideas

Candy Cane Cookies

5 from 1 vote
1 Comments
Chef Elena
By: Chef ElenaUpdated: Jul 21, 2026
This post may contain affiliate links. Please read our disclosure policy.

Buttery, peppermint-swirled cookies shaped like classic candy canes. A festive cookie that bakes up crisp at the edges and tender in the center, perfect for holiday plates and cookie swaps.

Candy Cane Cookies

This recipe for Candy Cane Cookies has been a holiday mainstay in my kitchen for years and it always brings a little magic to the table. I discovered this version during a December I wanted to make something nostalgic but simple enough to bake with kids. The result is a cookie that balances a rich butter base with a faint peppermint lift. The edges bake to a gentle crisp while the centers remain tender, and the red swirl gives every cookie a cheerful, vintage look. I still remember my niece insisting we make them again the next morning, nibbling one before breakfast.

What makes these special is how approachable they are. The dough comes together quickly, uses pantry staples, and does not require chilling for long. The peppermint extract is subtle so the butter flavor can shine, and shaping the ropes into candy cane curves is a relaxing, almost meditative task. They are ideal for gift tins, neighborhood exchanges, and a quiet afternoon of baking with a holiday playlist. With a few small tips you will end up with uniform cookies that hold their shape and deliver consistent texture every time.

Why You'll Love This Recipe

  • The dough is straightforward and ready in about 20 minutes of active prep, which makes these great for last minute holiday baking and weekend projects.
  • Uses common pantry ingredients like all purpose flour and powdered sugar so you rarely need a special store run to start baking.
  • Soft centers with lightly golden bottoms provide a pleasing contrast in texture, and the peppermint extract offers just enough brightness without overpowering the butter.
  • Easy to scale. Make a double batch for large gatherings or cut the recipe in half to bake a smaller tray for an evening treat.
  • Make ahead friendly. The formed cookies can be baked from cold or assembled and stored in the refrigerator overnight so you can bake fresh on the day you need them.
  • Kid friendly shaping technique. Rolling and twisting teaches simple baking skills and is fun for helpers of all ages.

When I first made them for a community cookie swap, neighbors asked for the recipe immediately. I learned that coloring with a gel food color yields a deeper red without thinning the dough. Also, working with slightly warmed hands helps when rolling ropes. There is a small delight in bending the twisted ropes into the classic candy cane curve and seeing a tray of identical, festive cookies ready for the oven.

Ingredients

  • Unsalted butter, 1 cup: Use two sticks of good quality butter at room temperature for creaming. I use Land O Lakes or Plugra when available. Butter quality affects flavor and spread so keep it softened not melted.
  • Powdered sugar, 1 cup: Also called confectioners sugar, it creates a tender, melt in the mouth crumb. Sift it if lumpy. C&H works reliably.
  • Large egg, 1: Room temperature egg blends more smoothly and helps with structure and a tender crumb. Remove from fridge 30 minutes before mixing.
  • Vanilla extract, 1 teaspoon: Pure vanilla adds depth. I prefer Nielsen Massey for consistent flavor.
  • Peppermint extract, 1/2 teaspoon: Use a measured amount because peppermint can dominate. Start with 1/2 teaspoon and add a touch more only if you want a stronger mint note.
  • All purpose flour, 2 1/2 cups: Spoon and level the flour to avoid over measuring. King Arthur and Bob's Red Mill both produce reliable results.
  • Salt, 1/2 teaspoon: Balances sweetness and lifts the butter notes. Table salt or fine sea salt both work.
  • Red gel food coloring: Gel color gives a vibrant hue without changing dough hydration. Use a toothpick to add small amounts until you reach the desired red.

Instructions

Prep oven and pansPreheat the oven to 375 F. Line baking sheets with parchment paper and set aside. Having parchment in place prevents sticking and promotes even browning. Position racks in the middle third of the oven for the most consistent results.Cream butter and powdered sugarIn a large bowl or stand mixer fitted with the paddle, beat the softened butter and powdered sugar together on medium speed until pale and fluffy, about 3 to 4 minutes. Scrape down the sides once. This step aerates the fat and creates the base texture for a tender cookie.Add egg and extractsBeat in the room temperature egg until smooth, then add the vanilla and peppermint extracts. Mix until fully incorporated and the mixture appears glossy and slightly thickened. Avoid over mixing once the egg is added to keep the dough tender.Mix in dry ingredientsSift the flour with the salt into the wet mixture in two additions, folding gently between additions. Mix on low until the flour is just incorporated. The dough should be soft and slightly tacky but not sticky. If it feels sticky, lightly dust your hands with flour when shaping.Divide and colorDivide the dough into two equal portions. Add red gel food coloring to one half by mixing a little at a time until you reach a deep red. Knead briefly in the bowl or on a clean surface until color is uniform. Wear gloves if you prefer to avoid staining hands.Shape into ropes and twistPinch off about 1 teaspoon of each colored dough and roll into 4 inch ropes between your palms. Lay one red rope next to one plain rope and gently press them together lengthwise. Twist the two ropes together, then curve the top to form a candy cane shape. Repeat until all dough is used. Keep any shaped pieces on a parchment lined sheet as you work.Bake and coolBake the cookies on the prepared sheets for 8 to 10 minutes, or until the bottoms are just turning light golden. They will be soft out of the oven. Allow cookies to cool on the baking sheet for 5 minutes before transferring to a wire rack to cool completely. This brief rest helps them finish setting without cracking.User provided content image 1

You Must Know

  • These keep well stored in an airtight container at room temperature for up to 5 days and freeze well for 3 months.
  • They are not dairy free due to the butter and not gluten free due to wheat flour.
  • Use gel food color to preserve dough consistency and avoid watering down the texture.
  • The peppermint flavor is concentrated so measure carefully and taste an extra scrap of dough before adding more.

My favorite part of this cookie is how the simple twist transforms two plain pieces of dough into something festive and elegant. Over the years I have taught many friends to form the ropes and watched their immediate delight when the first tray emerges from the oven. The dough is forgiving so even imperfect twists look charming on a holiday platter. These cookies have been requested for birthdays and winter potlucks, proving they are not only seasonal but crowd pleasers for any time you want a small, minty, buttery bite.

Storage Tips

Store completely cooled cookies in an airtight container layered between sheets of parchment to prevent sticking. At room temperature they retain texture for up to five days. For longer storage freeze the baked cookies in a single layer until firm then transfer to a freezer safe bag for up to three months. To reheat frozen cookies, let them come to room temperature for 20 minutes or warm briefly in a 300 F oven for five minutes to refresh crisp edges without drying the center.

Ingredient Substitutions

If you need a dairy free version substitute a high quality vegan butter stick one for one and increase the powdered sugar by a tablespoon to compensate for slightly higher water content in some plant butters. For an egg free option replace the egg with 2 tablespoons aquafaba whisked until slightly frothy, though texture will be a touch less tender. To reduce sugar slightly, use 3/4 cup powdered sugar plus 2 tablespoons of granulated sugar, noting texture becomes slightly firmer.

Serving Suggestions

Serve these on a holiday cookie board with chocolate dipped pretzels, shortbread, and peppermint bark for contrast. They pair especially well with a cup of hot chocolate or strong coffee. For gifting arrange six to eight in a clear cellophane bag tied with a ribbon and include a small handwritten tag saying enjoy. Garnish a plated stack with a few fresh mint leaves for color contrast when serving at parties.

User provided content image 2

Cultural Background

The candy cane shape evokes classic Western holiday imagery and traces its modern popularity to 19th century traditions when shaped candies were used to ornament trees and festive tables. The cookie adaptation blends that candy tradition with classic butter cookie techniques, making them a seasonal staple in many American homes. The peppermint note is associated with winter holiday flavors and the visual red and white stripes are instantly recognizable as festive.

Seasonal Adaptations

For winter add a pinch of ground ginger or cinnamon to the dough for warmth, or swap peppermint extract for orange extract for a citrus twist at holiday brunch. In summer swap the peppermint for vanilla and color one half pastel pink or pale blue for themed gatherings. The shaping technique works with different color combinations so you can tailor the cookies to party palettes and special occasions.

Meal Prep Tips

Prepare the dough a day ahead and keep each color portion wrapped tightly in plastic wrap in the refrigerator. On baking day roll, twist, and bake fresh. This divides work into manageable steps and frees time on the day you plan to serve. Shaped but unbaked cookies will hold in the fridge for up to 48 hours. If you need more urgent prep, freeze shaped raw cookies on a sheet until firm and bake directly from frozen, adding a minute or two to the baking time.

These cookies are a small holiday pleasure that invite sharing. I encourage you to make a double batch and test small variations to find your favorite balance of peppermint and butter notes. Baking is better with company so put on some music and invite helpers to twist the ropes and form a little assembly line of festive treats.

Pro Tips

  • Use room temperature butter and egg to ensure smooth incorporation and a tender crumb.

  • Roll ropes with slightly floured or warm palms to keep dough from sticking and to achieve consistent 4 inch lengths.

  • If dough feels sticky chill briefly for 10 minutes, then continue shaping to prevent excessive spreading in the oven.

  • Measure flour by spooning into the cup then leveling to avoid dense cookies from overpacking.

This nourishing candy cane cookies recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I prepare the cookies ahead of time?

Yes. Shaped raw cookies can be refrigerated overnight for up to 48 hours. Bake directly from cold for the same bake time.

What food coloring should I use?

Use gel food coloring a little at a time until you reach the color you want. Liquid dyes will alter dough hydration.

Tags

Snack Hackscookiesholiday-bakingdessertsfamily-friendlyrecipe
No ratings yet

Candy Cane Cookies

This Candy Cane Cookies recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 24 steaks
Candy Cane Cookies
Prep:20 minutes
Cook:10 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

Cookie Base

Decoration

Instructions

1

Preheat and prepare pans

Preheat oven to 375 F and line baking sheets with parchment paper. Position the oven rack in the middle third for even baking.

2

Cream butter and sugar

Beat softened butter and powdered sugar on medium speed until pale and fluffy about 3 to 4 minutes. Scrape the bowl to ensure even mixing.

3

Add egg and extracts

Mix in the room temperature egg until smooth, then add vanilla and peppermint extract and blend until glossy. Avoid over mixing.

4

Incorporate dry ingredients

Add flour and salt in two additions, mixing on low until just combined. Dough should be soft and not sticky; avoid overworking.

5

Divide and color

Split dough in half. Add gel food coloring to one half a little at a time until fully colored. Knead briefly to distribute color evenly.

6

Roll, twist, and shape

Roll 1 teaspoon of each color into 4 inch ropes. Place ropes side by side, press lightly, twist together and bend the top to form a candy cane shape.

7

Bake and cool

Bake 8 to 10 minutes until bottoms are lightly golden. Cool on pan 5 minutes then transfer to a wire rack to cool completely.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 150kcal | Carbohydrates: 18g | Protein:
2g | Fat: 8g | Saturated Fat: 2g |
Polyunsaturated Fat: 2g | Monounsaturated Fat:
3g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@magicmealideas on social media!

Candy Cane Cookies

Categories:

Candy Cane Cookies

Did You Make This?

Leave a comment & rating below or tag @magicmealideas on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Chef!

Chef and recipe creator specializing in delicious Snack Hacks cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.